PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010556573.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 329aa    MW: 36319.1 Da    PI: 8.4637
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010556573.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-1375119147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   XP_010556573.1  75 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 119
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1669125IPR009057Homeodomain-like
PROSITE profilePS5129415.40870124IPR017930Myb domain
TIGRFAMsTIGR015571.5E-1873122IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-673125IPR009057Homeodomain-like
SMARTSM007175.3E-1174122IPR001005SANT/Myb domain
PfamPF002492.7E-1175119IPR001005SANT/Myb domain
CDDcd001672.02E-877120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVSVNPSPAQ GFPFFDPMNV GLTGLNTLPH APAEGLGAGT IGPMPVSGRR RGSTMSFAED  60
PARKIRKPYT ITKSRESWTE QEHDKFLEAL QLFDRDWKKI EAFVGSKTVI QIRSHAQKYF  120
LKVQKSGTSE HLPPPRPKRK ATHPYPQKAQ KSVALVPPVN VSFPPSSSLL EPGCLYNTDS  180
QSLLGNPVVN APVSSFCKYG SLHPSNVPQQ VIEEESGVST QAATTNCCYS SSSTEDTQRT  240
QTITAPNDQE SCEKPLSVMP NFAEVYRFIG SVFDPSATGH VQKLKQMDPI NLETVMLLMR  300
NLSVNLASPE LEEHRRLLSS YNDRTTKET
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00423DAPTransfer from AT4G01280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010556573.10.0PREDICTED: protein REVEILLE 5
SwissprotC0SVG51e-132RVE5_ARATH; Protein REVEILLE 5
TrEMBLV4KIR61e-138V4KIR6_EUTSA; Uncharacterized protein
STRINGAT4G01280.21e-130(Arabidopsis thaliana)
STRINGPOPTR_0014s08520.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12902893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.11e-132MYB_related family protein